SCOPe 2.07: Domain d1ndpb_: 1ndp B:

Lineage for d1ndpb_ (1ndp B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)

8. Domain d1ndpb_: 1ndp B: [39114]
   complexed with adp, mg

Details for d1ndpb_

PDB Entry: 1ndp, 2.2 Å

PDB Description: adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1ndpb_:

Sequence; same for both SEQRES and ATOM records:

>d1ndpb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1ndpb_:

• d1ndpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ndpb_ appears in SCOPe 2.06
  
• d1ndpb_ appears in the current release, SCOPe 2.08