Lineage for d1ndpa_ (1ndp A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518282Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2518451Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)
  8. 2518467Domain d1ndpa_: 1ndp A: [39113]
    complexed with adp, mg

Details for d1ndpa_

PDB Entry: 1ndp (more details), 2.2 Å

PDB Description: adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1ndpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndpa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d1ndpa_:

Click to download the PDB-style file with coordinates for d1ndpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ndpa_: