Lineage for d6m2md_ (6m2m D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2699096Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [391060] (3 PDB entries)
  8. 2699104Domain d6m2md_: 6m2m D: [391101]
    automated match to d5gt0d_
    complexed with gol

Details for d6m2md_

PDB Entry: 6m2m (more details), 2.85 Å

PDB Description: a role for histone chaperone oschz1 in histone recognition and deposition
PDB Compounds: (D:) Histone H2B.1

SCOPe Domain Sequences for d6m2md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m2md_ a.22.1.1 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykiyifkvlkqvhpdigisskamgimnsfindifeklaqessklarynkkptitsreiq
tavrlvlpgelakhavsegtkavtkfts

SCOPe Domain Coordinates for d6m2md_:

Click to download the PDB-style file with coordinates for d6m2md_.
(The format of our PDB-style files is described here.)

Timeline for d6m2md_: