SCOPe 2.07: Domain d6m1jb_: 6m1j B:

Lineage for d6m1jb_ (6m1j B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (21 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [391026] (2 PDB entries)

8. Domain d6m1jb_: 6m1j B: [391086]
   automated match to d4baed_
   protein/DNA complex; complexed with dms, ez6, na, so4

Details for d6m1jb_

PDB Entry: 6m1j, 1.7 Å

PDB Description: the dna gyrase b atp binding domain of pseudomonas aeruginosa in complex with compound 12x

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d6m1jb_:

Sequence, based on SEQRES records:

>d6m1jb_ d.122.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gldavrkrpgmyigdtddgtglhhmvfevvdnsidealagycseisitihtdesitvrdn
grgipvdihkeegvsaaevimtvlhaggkfddntykvsgglhgvgvsvvnalshelrlti
rrhnkvweqvyhhgvpqfplrevgetdgsgtevhfkpspetfsnihfswdilakrirels
flnsgvgillrdertgkeelfkyeg

Sequence, based on observed residues (ATOM records):

>d6m1jb_ d.122.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gldavrkrpgmyigdtddgtglhhmvfevvdnsidealagycseisitihtdesitvrdn
grgipvdihkeegvsaaevimtvlgvgvsvvnalshelrltirrhnkvweqvyhhgvpqf
plrevgetdgsgtevhfkpspetfsnihfswdilakrirelsflnsgvgillrdertgke
elfkyeg

Timeline for d6m1jb_:

• d6m1jb_ is new in SCOPe 2.07-stable
  
• d6m1jb_ appears in the current release, SCOPe 2.08