SCOPe 2.08: Domain d6lx2a_: 6lx2 A:

Lineage for d6lx2a_ (6lx2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Amylomaltase MalQ [51478] (3 species)
   4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold

7. Species Potato (Solanum tuberosum) [TaxId:4113] [141771] (4 PDB entries)
   Uniprot Q06801 54-576

8. Domain d6lx2a_: 6lx2 A: [391071]
   automated match to d1x1na1
   complexed with ca, g4d
   has additional insertions and/or extensions that are not grouped together

Details for d6lx2a_

PDB Entry: 6lx2, 2.05 Å

PDB Description: potato d-enzyme complexed with ca26

PDB Compounds: (A:) 4-alpha-glucanotransferase, chloroplastic/amyloplastic

SCOPe Domain Sequences for d6lx2a_:

Sequence; same for both SEQRES and ATOM records:

>d6lx2a_ c.1.8.1 (A:) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]}
vpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhlag
cslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptdr
vnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvnt
iswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimgd
mpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdgf
swwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqavg
kiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgthd
ndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgsd
srmnipatqfgnwswripsstsfdnldaeakklrdilatygrl

Timeline for d6lx2a_:

• d6lx2a_ first appeared in SCOPe 2.07