Lineage for d1kdnc_ (1kdn C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194533Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)
  8. 2194542Domain d1kdnc_: 1kdn C: [39107]
    complexed with adp, af3, mg

Details for d1kdnc_

PDB Entry: 1kdn (more details), 2 Å

PDB Description: structure of nucleoside diphosphate kinase
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1kdnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdnc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d1kdnc_:

Click to download the PDB-style file with coordinates for d1kdnc_.
(The format of our PDB-style files is described here.)

Timeline for d1kdnc_: