SCOP 1.61: Domain d1kdnb_: 1kdn B:

Lineage for d1kdnb_ (1kdn B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (18 PDB entries)

8. Domain d1kdnb_: 1kdn B: [39106]

Details for d1kdnb_

PDB Entry: 1kdn, 2 Å

PDB Description: structure of nucleoside diphosphate kinase

SCOP Domain Sequences for d1kdnb_:

Sequence; same for both SEQRES and ATOM records:

>d1kdnb_ d.58.6.1 (B:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1kdnb_:

• d1kdnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kdnb_ appears in SCOP 1.59
  
• d1kdnb_ appears in SCOP 1.63
  
• d1kdnb_ appears in the current release, SCOPe 2.08