Lineage for d6m4wc_ (6m4w C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914805Species Human (Homo sapiens) [TaxId:9606] [189406] (17 PDB entries)
  8. 2914840Domain d6m4wc_: 6m4w C: [391059]
    Other proteins in same PDB: d6m4wg1, d6m4wg2, d6m4wh1, d6m4wh2, d6m4wi1, d6m4wi2
    automated match to d1a7la_
    complexed with gol, rap; mutant

Details for d6m4wc_

PDB Entry: 6m4w (more details), 3.11 Å

PDB Description: crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin
PDB Compounds: (C:) chimera of Maltose/maltodextrin-binding periplasmic protein and Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6m4wc_:

Sequence, based on SEQRES records: (download)

>d6m4wc_ c.94.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnaaamgvqvetispgdgrtfpkrgqtcvvhytgmle

Sequence, based on observed residues (ATOM records): (download)

>d6m4wc_ c.94.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkaksalmfnlqepyftwpliaadggyafkyaagkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsavny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daqtnaaamgvqvetispgdgrfpkrgqtcvvhytgmle

SCOPe Domain Coordinates for d6m4wc_:

Click to download the PDB-style file with coordinates for d6m4wc_.
(The format of our PDB-style files is described here.)

Timeline for d6m4wc_: