SCOPe 2.07: Domain d6m4ka2: 6m4k A:422-510

Lineage for d6m4ka2 (6m4k A:422-510)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Eisenia fetida [TaxId:6396] [391055] (3 PDB entries)

8. Domain d6m4ka2: 6m4k A:422-510 [391056]
   Other proteins in same PDB: d6m4ka1, d6m4ka3, d6m4ka4
   automated match to d1vaha1
   complexed with 1pe, act, ca, cl, pg4, so4

Details for d6m4ka2

PDB Entry: 6m4k, 1.3 Å

PDB Description: x-ray crystal structure of wild type alpha-amylase i from eisenia fetida

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6m4ka2:

Sequence; same for both SEQRES and ATOM records:

>d6m4ka2 b.71.1.0 (A:422-510) automated matches {Eisenia fetida [TaxId: 6396]}
wwdngfqaiafgrgnrgfifinnedfaitqtlqtglpggeycdviscdnnrppcgnsgga
cratvivngdgtatfdvpngenpmiaihv

Timeline for d6m4ka2:

• d6m4ka2 is new in SCOPe 2.07-stable
  
• d6m4ka2 appears in the current release, SCOPe 2.08