SCOPe 2.07: Domain d6m4ga_: 6m4g A:

Lineage for d6m4ga_ (6m4g A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (6 species)

7. Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (6 PDB entries)
   Uniprot P68433 38-135

8. Domain d6m4ga_: 6m4g A: [391042]
   Other proteins in same PDB: d6m4gb_, d6m4gc_, d6m4gd_, d6m4gf_, d6m4gg_, d6m4gh_
   automated match to d1u35a1

Details for d6m4ga_

PDB Entry: 6m4g, 2.8 Å

PDB Description: structural mechanism of nucleosome dynamics governed by human histone variants h2a.b and h2a.z.2.2

PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d6m4ga_:

Sequence; same for both SEQRES and ATOM records:

>d6m4ga_ a.22.1.1 (A:) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]}
llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
mpkdiqlarrirge

Timeline for d6m4ga_:

• d6m4ga_ is new in SCOPe 2.07-stable
  
• d6m4ga_ appears in the current release, SCOPe 2.08