Lineage for d6lrza1 (6lrz A:321-613)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.11: Kelch motif [117281] (2 families) 
Family b.68.11.1: Kelch motif [117282] (2 proteins)
Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
Protein automated matches [190126] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries) 
Domain d6lrza1: 6lrz A:321-613 [391035]
Other proteins in same PDB: d6lrza2
automated match to d2dyha_
complexed with act, eou, pg5, so4
Details for d6lrza1
PDB Entry: 6lrz (more details), 1.54 Å
PDB Description: crystal structure of keap1 in complex with dimethyl fumarate (dmf)
PDB Compounds: (A:) Keap1-DCSCOPe Domain Sequences for d6lrza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lrza1 b.68.11.1 (A:321-613) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggr
nnspdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssv
eryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmi
tpmntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgit
vhqgkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
SCOPe Domain Coordinates for d6lrza1:
Click to download the PDB-style file with coordinates for d6lrza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6lrza1:
- d6lrza1 is new in SCOPe 2.07-stable
- d6lrza1 appears in the current release, SCOPe 2.08
View in 3D
