SCOP 1.71: Domain d1f3fc_: 1f3f C:

Lineage for d1f3fc_ (1f3f C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (21 PDB entries)

8. Domain d1f3fc_: 1f3f C: [39103]
   complexed with d4d, d4t, mg, po4; mutant

Details for d1f3fc_

PDB Entry: 1f3f, 1.85 Å

PDB Description: structure of the h122g nucleoside diphosphate kinase / d4t- triphosphate.mg complex

SCOP Domain Sequences for d1f3fc_:

Sequence; same for both SEQRES and ATOM records:

>d1f3fc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1f3fc_:

• d1f3fc_ first appeared (with stable ids) in SCOP 1.55
  
• d1f3fc_ appears in SCOP 1.69
  
• d1f3fc_ appears in SCOP 1.73
  
• d1f3fc_ appears in the current release, SCOPe 2.08