| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries) |
| Domain d1f3fc_: 1f3f C: [39103] complexed with d4d, d4t, mg, po4 |
PDB Entry: 1f3f (more details), 1.85 Å
SCOPe Domain Sequences for d1f3fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3fc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye
Timeline for d1f3fc_: