Lineage for d6ly5e_ (6ly5 e:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393474Species Chaetoceros gracilis [TaxId:184592] [391019] (1 PDB entry)
  8. 2393475Domain d6ly5e_: 6ly5 e: [391020]
    Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5c_, d6ly5d_, d6ly5f_, d6ly5j_
    automated match to d4xk8e_
    complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5e_

PDB Entry: 6ly5 (more details), 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex
PDB Compounds: (e:) PsaE

SCOPe Domain Sequences for d6ly5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ly5e_ b.34.4.0 (e:) automated matches {Chaetoceros gracilis [TaxId: 184592]}
gpkrgakvkilrkesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldeiq
eve

SCOPe Domain Coordinates for d6ly5e_:

Click to download the PDB-style file with coordinates for d6ly5e_.
(The format of our PDB-style files is described here.)

Timeline for d6ly5e_: