Lineage for d1f3fb_ (1f3f B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951247Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)
  8. 2951251Domain d1f3fb_: 1f3f B: [39102]
    complexed with d4d, d4t, mg, po4

Details for d1f3fb_

PDB Entry: 1f3f (more details), 1.85 Å

PDB Description: structure of the h122g nucleoside diphosphate kinase / d4t- triphosphate.mg complex
PDB Compounds: (B:) protein (nucleoside diphosphate kinase)

SCOPe Domain Sequences for d1f3fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3fb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d1f3fb_:

Click to download the PDB-style file with coordinates for d1f3fb_.
(The format of our PDB-style files is described here.)

Timeline for d1f3fb_: