Lineage for d6ly5a_ (6ly5 a:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633149Species Chaetoceros gracilis [TaxId:184592] [391015] (1 PDB entry)
  8. 2633150Domain d6ly5a_: 6ly5 a: [391016]
    Other proteins in same PDB: d6ly5c_, d6ly5d_, d6ly5e_, d6ly5f_, d6ly5j_
    automated match to d4y28a_
    complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5a_

PDB Entry: 6ly5 (more details), 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex
PDB Compounds: (a:) PsaA

SCOPe Domain Sequences for d6ly5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ly5a_ f.29.1.1 (a:) automated matches {Chaetoceros gracilis [TaxId: 184592]}
knvqifvekdavetsfekwsqpghfsrtlakgpktttwiwnlhadahdfdsqtnsleevs
rkifsahfgqlaaiflwisgmhfhgayfsnysawlsdpikikqssqvvwpivgqeilnad
vggnfqgvqttsgwfqmwraegitsevelywiaigglimsalmlfagwfhyhkaapklew
fqnaesmmnhhlagllglgclswsghqihialpinklldagvspqeiplpheflinrdlm
aqlypsfekgltpffsgqwgvysdfltfkgglnpvtgglwlsdiahhhlalsvlfiiagh
myrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlamigslsiivahh
myamppypyiatdyatqlslfthhmwiggfcvvggaahgaifmvrdytpannynnlldrd
lrhrdeiisnlnwvciflgchafgfyihndtmralgrpqdmfsdkaiqlqpifaqwiqni
hllapgttapnalattsyafggdivevggkiammpiklgtadfmvhhihaftihvtvlil
lkgvlyarssklipdkanlgfrfpcdgpgrggtcqssswdhvflglfwmynaisvvifhf
swkmqsdvwgtvtadgsishitggnfaqssitingwlrdflwsqasqviqsygsassayg
liflgahfiwafslmflfsgrgywqeliesivwahnklnfapaiqpralsitqgravgla
hyllggigttwafflarslsit

SCOPe Domain Coordinates for d6ly5a_:

Click to download the PDB-style file with coordinates for d6ly5a_.
(The format of our PDB-style files is described here.)

Timeline for d6ly5a_: