SCOPe 2.04: Domain d1f3fa_: 1f3f A:

Lineage for d1f3fa_ (1f3f A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (21 PDB entries)

8. Domain d1f3fa_: 1f3f A: [39101]
   complexed with d4d, d4t, mg, po4

Details for d1f3fa_

PDB Entry: 1f3f, 1.85 Å

PDB Description: structure of the h122g nucleoside diphosphate kinase / d4t- triphosphate.mg complex

PDB Compounds: (A:) protein (nucleoside diphosphate kinase)

SCOPe Domain Sequences for d1f3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1f3fa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1f3fa_:

• d1f3fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f3fa_ appears in SCOPe 2.03
  
• d1f3fa_ appears in SCOPe 2.05
  
• d1f3fa_ appears in the current release, SCOPe 2.08