Lineage for d6ly5d_ (6ly5 d:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611462Species Chaetoceros gracilis [TaxId:184592] [391007] (1 PDB entry)
  8. 2611463Domain d6ly5d_: 6ly5 d: [391008]
    Other proteins in same PDB: d6ly5a_, d6ly5b_, d6ly5c_, d6ly5e_, d6ly5f_, d6ly5j_
    automated match to d4xk8d_
    complexed with a86, bcr, cla, dd6, dgd, kc1, lhg, lmg, lmt, pqn, sf4, sqd

Details for d6ly5d_

PDB Entry: 6ly5 (more details), 2.38 Å

PDB Description: organization and energy transfer in a huge diatom psi-fcpi supercomplex
PDB Compounds: (d:) PsaD

SCOPe Domain Sequences for d6ly5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ly5d_ d.187.1.1 (d:) automated matches {Chaetoceros gracilis [TaxId: 184592]}
pspifggstggwlrkaqveekyvitwdspkeqifemptggaaimregpnllklarkeqcl
algtrlrskykikyqfyrvfpngevqylhpkdgvypekvnagrqgvgqnfrsigknvspi
evkftgkqpydl

SCOPe Domain Coordinates for d6ly5d_:

Click to download the PDB-style file with coordinates for d6ly5d_.
(The format of our PDB-style files is described here.)

Timeline for d6ly5d_: