Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
Domain d4lxvd_: 4lxv D: [391002] Other proteins in same PDB: d4lxva1, d4lxva2, d4lxvc1, d4lxvc2, d4lxve1, d4lxve2, d4lxvg1, d4lxvg2, d4lxvi1, d4lxvi2, d4lxvk1, d4lxvk2 automated match to d3m5jb_ complexed with nag |
PDB Entry: 4lxv (more details), 3 Å
SCOPe Domain Sequences for d4lxvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lxvd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmnt qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek vrnqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
Timeline for d4lxvd_: