SCOP 1.61: Domain d1npk__: 1npk -

Lineage for d1npk__ (1npk -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (18 PDB entries)

8. Domain d1npk__: 1npk - [39099]

Details for d1npk__

PDB Entry: 1npk, 1.8 Å

PDB Description: refined x-ray structure of dictyostelium nucleoside diphosphate kinase at 1,8 angstroms resolution

SCOP Domain Sequences for d1npk__:

Sequence; same for both SEQRES and ATOM records:

>d1npk__ d.58.6.1 (-) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1npk__:

• d1npk__ first appeared (with stable ids) in SCOP 1.55
  
• d1npk__ appears in SCOP 1.59
  
• d1npk__ appears in SCOP 1.63
  
• d1npk__ appears in the current release, SCOPe 2.08, called d1npka_