Lineage for d1npka_ (1npk A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries) 
Domain d1npka_: 1npk A: [39099]
Details for d1npka_
PDB Entry: 1npk (more details), 1.8 Å
PDB Description: refined x-ray structure of dictyostelium nucleoside diphosphate kinase at 1,8 angstroms resolution
PDB Compounds: (A:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d1npka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npka_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye
SCOPe Domain Coordinates for d1npka_:
Click to download the PDB-style file with coordinates for d1npka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1npka_:
- d1npka_ first appeared (with stable ids) in SCOP 1.55, called d1npk__
- d1npka_ appears in SCOPe 2.07
View in 3D