SCOP 1.61: Domain d1bhnf_: 1bhn F:

Lineage for d1bhnf_ (1bhn F:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)

8. Domain d1bhnf_: 1bhn F: [39098]

Details for d1bhnf_

PDB Entry: 1bhn, 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform a from bovine retina

SCOP Domain Sequences for d1bhnf_:

Sequence; same for both SEQRES and ATOM records:

>d1bhnf_ d.58.6.1 (F:) Nucleoside diphosphate kinases {Cow (Bos taurus)}
ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfhpeelvnykscaqnwiye

Timeline for d1bhnf_:

• d1bhnf_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhnf_ appears in SCOP 1.59
  
• d1bhnf_ appears in SCOP 1.63
  
• d1bhnf_ appears in the current release, SCOPe 2.08