Lineage for d1bhnf_ (1bhn F:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32559Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 32560Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 32561Protein Nucleoside diphosphate kinases [54921] (6 species)
  7. 32562Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)
  8. 32571Domain d1bhnf_: 1bhn F: [39098]

Details for d1bhnf_

PDB Entry: 1bhn (more details), 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform a from bovine retina

SCOP Domain Sequences for d1bhnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhnf_ d.58.6.1 (F:) Nucleoside diphosphate kinases {Cow (Bos taurus)}
ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfhpeelvnykscaqnwiye

SCOP Domain Coordinates for d1bhnf_:

Click to download the PDB-style file with coordinates for d1bhnf_.
(The format of our PDB-style files is described here.)

Timeline for d1bhnf_: