Lineage for d6lr3j_ (6lr3 J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961039Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2961377Species Oncomelania hupensis [TaxId:56141] [390952] (2 PDB entries)
  8. 2961387Domain d6lr3j_: 6lr3 J: [390973]
    automated match to d1uiza_
    complexed with so4

Details for d6lr3j_

PDB Entry: 6lr3 (more details), 1.77 Å

PDB Description: structural and functional insights into macrophage migration inhibitory factor from oncomelania hupensis, the intermediate host of schistosoma japonicum
PDB Compounds: (J:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d6lr3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lr3j_ d.80.1.3 (J:) Microphage migration inhibition factor (MIF) {Oncomelania hupensis [TaxId: 56141]}
pvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfat
vecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsi

SCOPe Domain Coordinates for d6lr3j_:

Click to download the PDB-style file with coordinates for d6lr3j_.
(The format of our PDB-style files is described here.)

Timeline for d6lr3j_: