SCOPe 2.02: Domain d1bhne_: 1bhn E:

Lineage for d1bhne_ (1bhn E:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)

8. Domain d1bhne_: 1bhn E: [39097]
   complexed with 35g

Details for d1bhne_

PDB Entry: 1bhn, 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform a from bovine retina

PDB Compounds: (E:) nucleoside diphosphate transferase

SCOPe Domain Sequences for d1bhne_:

Sequence; same for both SEQRES and ATOM records:

>d1bhne_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Cow (Bos taurus) [TaxId: 9913]}
ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfhpeelvnykscaqnwiye

Timeline for d1bhne_:

• d1bhne_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhne_ appears in SCOPe 2.01
  
• d1bhne_ appears in SCOPe 2.03
  
• d1bhne_ appears in the current release, SCOPe 2.08