Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Cryptosporidium hominis [TaxId:237895] [256376] (3 PDB entries) |
Domain d6ltwa2: 6ltw A:131-259 [390968] automated match to d4odja2 complexed with mg, po4 |
PDB Entry: 6ltw (more details), 1.65 Å
SCOPe Domain Sequences for d6ltwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ltwa2 d.130.1.0 (A:131-259) automated matches {Cryptosporidium hominis [TaxId: 237895]} nvedigagdqgmmfgyatnetkelmplthvlatsitreldyirmkgvssrvgwlrpdgka qvtveynckhgvlipkrihtilvsvqhdenieneeirefvlenvikkvcpsdlmdketri linpsgrft
Timeline for d6ltwa2: