SCOPe 2.08: Domain d6ltwa2: 6ltw A:131-259

Lineage for d6ltwa2 (6ltw A:131-259)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [256376] (3 PDB entries)

8. Domain d6ltwa2: 6ltw A:131-259 [390968]
   automated match to d4odja2
   complexed with mg, po4

Details for d6ltwa2

PDB Entry: 6ltw, 1.65 Å

PDB Description: crystal structure of apo form of i122a/i330a variant of s- adenosylmethionine synthetase from cryptosporidium hominis

PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6ltwa2:

Sequence; same for both SEQRES and ATOM records:

>d6ltwa2 d.130.1.0 (A:131-259) automated matches {Cryptosporidium hominis [TaxId: 237895]}
nvedigagdqgmmfgyatnetkelmplthvlatsitreldyirmkgvssrvgwlrpdgka
qvtveynckhgvlipkrihtilvsvqhdenieneeirefvlenvikkvcpsdlmdketri
linpsgrft

Timeline for d6ltwa2:

• d6ltwa2 first appeared in SCOPe 2.07