Lineage for d4ln4b_ (4ln4 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041574Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries)
  8. 3041607Domain d4ln4b_: 4ln4 B: [390951]
    Other proteins in same PDB: d4ln4a_, d4ln4c_, d4ln4e_, d4ln4g_, d4ln4i_, d4ln4k_
    automated match to d3m5jb_
    complexed with nag

Details for d4ln4b_

PDB Entry: 4ln4 (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin form a h7n9 influenza virus (a/shanghai/1/2013) in complex with lstb
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4ln4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln4b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d4ln4b_:

Click to download the PDB-style file with coordinates for d4ln4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ln4b_: