SCOPe 2.07: Domain d6linb1: 6lin B:13-177

Lineage for d6linb1 (6lin B:13-177)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries)

8. Domain d6linb1: 6lin B:13-177 [390934]
   Other proteins in same PDB: d6lina2, d6lina3, d6linb2, d6linc2, d6linc3, d6lind2
   automated match to d2pnrb1
   complexed with eh0, gol, peg, so4

Details for d6linb1

PDB Entry: 6lin, 2.67 Å

PDB Description: crystal structure of human pdk2 complexed with gm10030

PDB Compounds: (B:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6linb1:

Sequence; same for both SEQRES and ATOM records:

>d6linb1 a.29.5.1 (B:13-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllp
drvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaq
gvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Timeline for d6linb1:

• d6linb1 is new in SCOPe 2.07-stable
  
• d6linb1 appears in the current release, SCOPe 2.08