SCOPe 2.05: Domain d1bhna_: 1bhn A:

Lineage for d1bhna_ (1bhn A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)

8. Domain d1bhna_: 1bhn A: [39093]
   complexed with 35g

Details for d1bhna_

PDB Entry: 1bhn, 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform a from bovine retina

PDB Compounds: (A:) nucleoside diphosphate transferase

SCOPe Domain Sequences for d1bhna_:

Sequence; same for both SEQRES and ATOM records:

>d1bhna_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Cow (Bos taurus) [TaxId: 9913]}
ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfhpeelvnykscaqnwiye

Timeline for d1bhna_:

• d1bhna_ first appeared (with stable ids) in SCOP 1.55
  
• d1bhna_ appears in SCOPe 2.04
  
• d1bhna_ appears in SCOPe 2.06
  
• d1bhna_ appears in the current release, SCOPe 2.08