Lineage for d1bhna_ (1bhn A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries) 
Domain d1bhna_: 1bhn A: [39093]
Details for d1bhna_
PDB Entry: 1bhn (more details), 2.4 Å
PDB Description: nucleoside diphosphate kinase isoform a from bovine retina
SCOP Domain Sequences for d1bhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhna_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Cow (Bos taurus)}
ansertfiaikpdgvqrgligeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfhpeelvnykscaqnwiye
SCOP Domain Coordinates for d1bhna_:
Click to download the PDB-style file with coordinates for d1bhna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bhna_:
- d1bhna_ appears in SCOP 1.57
- d1bhna_ appears in the current release, SCOPe 2.08
View in 3D
