SCOPe 2.08: Domain d6lboa_: 6lbo A:

Lineage for d6lboa_ (6lbo A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Echovirus e11 [TaxId:12078] [390854] (4 PDB entries)

8. Domain d6lboa_: 6lbo A: [390928]
   Other proteins in same PDB: d6lboc_
   automated match to d5xs4a1

Details for d6lboa_

PDB Entry: 6lbo, 3.18 Å

PDB Description: cryo-em structure of echovirus 11 empty particle at ph 7.4

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d6lboa_:

Sequence, based on SEQRES records:

>d6lboa_ b.121.4.0 (A:) automated matches {Echovirus e11 [TaxId: 12078]}
sessienflcrsacvymgeyhttntdtsklfaswtinarrmvqmrrklelftyvrfdmev
tfvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnapp
rmsipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmy
fkpkhvkvwvprpprlcqyknastvnftptnitekrqsinyipetv

Sequence, based on observed residues (ATOM records):

>d6lboa_ b.121.4.0 (A:) automated matches {Echovirus e11 [TaxId: 12078]}
sessienflcrsacvymgeyhttntdtsklfaswtinarrmvqmrrklelftyvrfdmev
tfvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnapp
rmsipfisignaysnfydgwshgvygyntlnhmgqiyvrhvngssplpmtstvrmyfkpk
hvkvwvprpprlcqyknastvnftptnitekrqsinyipetv

Timeline for d6lboa_:

• d6lboa_ first appeared in SCOPe 2.07