Lineage for d6kyjc2 (6kyj C:151-464)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838608Species Rice (Oryza sativa) [TaxId:4530] [117390] (5 PDB entries)
    Uniprot P12089
  8. 2838622Domain d6kyjc2: 6kyj C:151-464 [390927]
    Other proteins in same PDB: d6kyja1, d6kyjc1, d6kyje1, d6kyjg1, d6kyjs_, d6kyju_, d6kyjw_, d6kyjy_
    automated match to d1wdde1
    complexed with gol, so4

Details for d6kyjc2

PDB Entry: 6kyj (more details), 1.7 Å

PDB Description: hybrid-rubisco (rice rbcl and sorghum rbcs) in complex with sulfate ions
PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6kyjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kyjc2 c.1.14.1 (C:151-464) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
pphgiqverdklnkygrpllgctikpklglsaknygracyeclrggldftkddenvnsqp
fmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdyl
tggftantslahycrdnglllhihramhavidrqknhgmhfrvlakalrmsggdhihagt
vvgklegeremtlgfvdllrddfiekdrargifftqdwvsmpgvipvasggihvwhmpal
teifgddsvlqfgggtlghpwgnapgaaanrvaleacvqarnegrdlaregneiirsack
wspelaaaceiwka

SCOPe Domain Coordinates for d6kyjc2:

Click to download the PDB-style file with coordinates for d6kyjc2.
(The format of our PDB-style files is described here.)

Timeline for d6kyjc2: