SCOP 1.63: Domain d1be4c_: 1be4 C:

Lineage for d1be4c_ (1be4 C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)

8. Domain d1be4c_: 1be4 C: [39092]
   complexed with pcg

Details for d1be4c_

PDB Entry: 1be4, 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform b from bovine retina

SCOP Domain Sequences for d1be4c_:

Sequence; same for both SEQRES and ATOM records:

>d1be4c_ d.58.6.1 (C:) Nucleoside diphosphate kinases {Cow (Bos taurus)}
ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfrpeelvnykscaqnwiye

Timeline for d1be4c_:

• d1be4c_ first appeared (with stable ids) in SCOP 1.55
  
• d1be4c_ appears in SCOP 1.61
  
• d1be4c_ appears in SCOP 1.65
  
• d1be4c_ appears in the current release, SCOPe 2.08