SCOP 1.71: Domain d1be4b_: 1be4 B:

Lineage for d1be4b_ (1be4 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)

8. Domain d1be4b_: 1be4 B: [39091]

Details for d1be4b_

PDB Entry: 1be4, 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform b from bovine retina

SCOP Domain Sequences for d1be4b_:

Sequence; same for both SEQRES and ATOM records:

>d1be4b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Cow (Bos taurus)}
ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfrpeelvnykscaqnwiye

Timeline for d1be4b_:

• d1be4b_ first appeared (with stable ids) in SCOP 1.55
  
• d1be4b_ appears in SCOP 1.69
  
• d1be4b_ appears in SCOP 1.73
  
• d1be4b_ appears in the current release, SCOPe 2.08