Lineage for d6lila2 (6lil A:178-373)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973948Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 2973949Species Human (Homo sapiens) [TaxId:9606] [160702] (19 PDB entries)
    Uniprot Q15120 177-301
  8. 2973957Domain d6lila2: 6lil A:178-373 [390909]
    Other proteins in same PDB: d6lila1, d6lilb1
    automated match to d2pnrb2
    complexed with egx, flc, gol, peg, so4

Details for d6lila2

PDB Entry: 6lil (more details), 1.93 Å

PDB Description: crystal structure of human pdk2 complexed with an allosteric inhibitor compound 8c
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6lila2:

Sequence, based on SEQRES records: (download)

>d6lila2 d.122.1.4 (A:178-373) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdav
iylkalstdsverlpv

Sequence, based on observed residues (ATOM records): (download)

>d6lila2 d.122.1.4 (A:178-373) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
ghpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyvp
shlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkier
lfsymystagtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsver
lpv

SCOPe Domain Coordinates for d6lila2:

Click to download the PDB-style file with coordinates for d6lila2.
(The format of our PDB-style files is described here.)

Timeline for d6lila2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lila1