SCOPe 2.08: Domain d6lilb2: 6lil B:184-373

Lineage for d6lilb2 (6lil B:184-373)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)

6. Protein Pyruvate dehydrogenase kinase [69807] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160702] (19 PDB entries)
   Uniprot Q15120 177-301

8. Domain d6lilb2: 6lil B:184-373 [390906]
   Other proteins in same PDB: d6lila1, d6lilb1
   automated match to d2pnrb2
   complexed with egx, flc, gol, peg, so4

Details for d6lilb2

PDB Entry: 6lil, 1.93 Å

PDB Description: crystal structure of human pdk2 complexed with an allosteric inhibitor compound 8c

PDB Compounds: (B:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6lilb2:

Sequence, based on SEQRES records:

>d6lilb2 d.122.1.4 (B:184-373) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
hpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyvps
hlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkierl
fsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkal
stdsverlpv

Sequence, based on observed residues (ATOM records):

>d6lilb2 d.122.1.4 (B:184-373) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
hpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyvps
hlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkierl
fsymystagtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsverl
pv

Timeline for d6lilb2:

• d6lilb2 first appeared in SCOPe 2.07