Lineage for d6liob2 (6lio B:178-384)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973948Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 2973949Species Human (Homo sapiens) [TaxId:9606] [160702] (19 PDB entries)
    Uniprot Q15120 177-301
  8. 2973951Domain d6liob2: 6lio B:178-384 [390899]
    Other proteins in same PDB: d6lioa1, d6liob1, d6liob3
    automated match to d2pnrb2
    complexed with eh3, gol, so4

Details for d6liob2

PDB Entry: 6lio (more details), 1.76 Å

PDB Description: crystal structure of human pdk2 complexed with gm67520
PDB Compounds: (B:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6liob2:

Sequence, based on SEQRES records: (download)

>d6liob2 d.122.1.4 (B:178-384) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdav
iylkalstdsverlpvynksawrhyqt

Sequence, based on observed residues (ATOM records): (download)

>d6liob2 d.122.1.4 (B:178-384) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymysttplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstds
verlpvynksawrhyqt

SCOPe Domain Coordinates for d6liob2:

Click to download the PDB-style file with coordinates for d6liob2.
(The format of our PDB-style files is described here.)

Timeline for d6liob2: