Lineage for d6linc1 (6lin C:6-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708720Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 2708739Protein automated matches [230549] (2 species)
    not a true protein
  7. 2708740Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries)
  8. 2708755Domain d6linc1: 6lin C:6-177 [390892]
    Other proteins in same PDB: d6lina2, d6lina3, d6linb2, d6linc2, d6linc3, d6lind2
    automated match to d2pnrb1
    complexed with eh0, gol, peg, so4

Details for d6linc1

PDB Entry: 6lin (more details), 2.67 Å

PDB Description: crystal structure of human pdk2 complexed with gm10030
PDB Compounds: (C:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6linc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6linc1 a.29.5.1 (C:6-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
allknaslagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanim
keinllpdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhnd
vvptmaqgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d6linc1:

Click to download the PDB-style file with coordinates for d6linc1.
(The format of our PDB-style files is described here.)

Timeline for d6linc1: