Lineage for d1ehwb_ (1ehw B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603873Species Human (Homo sapiens), NDK4 [TaxId:9606] [54923] (1 PDB entry)
  8. 603875Domain d1ehwb_: 1ehw B: [39089]
    complexed with so4; mutant

Details for d1ehwb_

PDB Entry: 1ehw (more details), 2.4 Å

PDB Description: human nucleoside diphosphate kinase 4

SCOP Domain Sequences for d1ehwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehwb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4}
mgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkpf
ypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnvihas
dsvegaqreiqlwfqsselvsw

SCOP Domain Coordinates for d1ehwb_:

Click to download the PDB-style file with coordinates for d1ehwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ehwb_: