Lineage for d6lioa1 (6lio A:14-177)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321920Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2321921Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 2321940Protein automated matches [230549] (2 species)
    not a true protein
  7. 2321941Species Human (Homo sapiens) [TaxId:9606] [230552] (22 PDB entries)
  8. 2321942Domain d6lioa1: 6lio A:14-177 [390886]
    Other proteins in same PDB: d6lioa2, d6liob2, d6liob3
    automated match to d2pnrb1
    complexed with eh3, gol, so4

Details for d6lioa1

PDB Entry: 6lio (more details), 1.76 Å

PDB Description: crystal structure of human pdk2 complexed with gm67520
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d6lioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lioa1 a.29.5.1 (A:14-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d6lioa1:

Click to download the PDB-style file with coordinates for d6lioa1.
(The format of our PDB-style files is described here.)

Timeline for d6lioa1: