Lineage for d1ehwa_ (1ehw A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194454Species Human (Homo sapiens), NDK4 [TaxId:9606] [54923] (1 PDB entry)
  8. 2194455Domain d1ehwa_: 1ehw A: [39088]
    complexed with so4

Details for d1ehwa_

PDB Entry: 1ehw (more details), 2.4 Å

PDB Description: human nucleoside diphosphate kinase 4
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1ehwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]}
hmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkp
fypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnviha
sdsvegaqreiqlwfqsselvsw

SCOPe Domain Coordinates for d1ehwa_:

Click to download the PDB-style file with coordinates for d1ehwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ehwa_: