SCOPe 2.03: Domain d1ehwa_: 1ehw A:

Lineage for d1ehwa_ (1ehw A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDK4 [TaxId:9606] [54923] (1 PDB entry)

8. Domain d1ehwa_: 1ehw A: [39088]
   complexed with so4

Details for d1ehwa_

PDB Entry: 1ehw, 2.4 Å

PDB Description: human nucleoside diphosphate kinase 4

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1ehwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]}
hmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkp
fypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnviha
sdsvegaqreiqlwfqsselvsw

Timeline for d1ehwa_:

• d1ehwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ehwa_ appears in SCOPe 2.02
  
• d1ehwa_ appears in SCOPe 2.04
  
• d1ehwa_ appears in the current release, SCOPe 2.08