Lineage for d1ehwa_ (1ehw A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (6 species) 
Species Human (Homo sapiens), NDK4 [TaxId:9606] [54923] (1 PDB entry) 
Domain d1ehwa_: 1ehw A: [39088]
Details for d1ehwa_
PDB Entry: 1ehw (more details), 2.4 Å
PDB Description: human nucleoside diphosphate kinase 4
SCOP Domain Sequences for d1ehwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Human (Homo sapiens), NDK4}
hmgtrertlvavkpdgvqrrlvgdviqrferrgftlvgmkmlqapesvlaehyqdlrrkp
fypalirymssgpvvamvwegynvvrasramightdsaeaapgtirgdfsvhisrnviha
sdsvegaqreiqlwfqsselvsw
SCOP Domain Coordinates for d1ehwa_:
Click to download the PDB-style file with coordinates for d1ehwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehwa_:
- d1ehwa_ appears in SCOP 1.57
- d1ehwa_ appears in the current release, SCOPe 2.08
View in 3D
