SCOP 1.73: Domain d1nsko_: 1nsk O:

Lineage for d1nsko_ (1nsk O:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)

8. Domain d1nsko_: 1nsk O: [39087]
   CASP1

Details for d1nsko_

PDB Entry: 1nsk, 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2

PDB Compounds: (O:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1nsko_:

Sequence; same for both SEQRES and ATOM records:

>d1nsko_ d.58.6.1 (O:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

Timeline for d1nsko_:

• d1nsko_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsko_ appears in SCOP 1.71
  
• d1nsko_ appears in SCOP 1.75
  
• d1nsko_ appears in the current release, SCOPe 2.08