SCOPe 2.08: Domain d6la7e1: 6la7 E:5-176

Lineage for d6la7e1 (6la7 E:5-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d6la7e1: 6la7 E:5-176 [390861]
   Other proteins in same PDB: d6la7a_, d6la7c_, d6la7e2, d6la7f_
   automated match to d1exua2

Details for d6la7e1

PDB Entry: 6la7, 2.82 Å

PDB Description: cryo-em structure of echovirus 11 complexed with its uncoating receptor fcrn at ph 5.5

PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6la7e1:

Sequence; same for both SEQRES and ATOM records:

>d6la7e1 d.19.1.1 (E:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Timeline for d6la7e1:

• d6la7e1 first appeared in SCOPe 2.07