SCOPe 2.08: Domain d6la3a_: 6la3 A:

Lineage for d6la3a_ (6la3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Echovirus e11 [TaxId:12078] [390813] (10 PDB entries)

8. Domain d6la3a_: 6la3 A: [390860]
   automated match to d2x5ia_
   complexed with sph

Details for d6la3a_

PDB Entry: 6la3, 2.32 Å

PDB Description: cryo-em structure of full echovirus 11 particle at ph 7.4

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d6la3a_:

Sequence; same for both SEQRES and ATOM records:

>d6la3a_ b.121.4.1 (A:) automated matches {Echovirus e11 [TaxId: 12078]}
vveavenavarvadtissgpsnsqavpaltavetghtsqvtpsdtiqtrhvrnyhsrses
sienflcrsacvymgeyhttntdtsklfaswtinarrmvqmrrklelftyvrfdmevtfv
itskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnapprms
ipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyfkp
khvkvwvprpprlcqyknastvnftptnitekrqsinyipetvkp

Timeline for d6la3a_:

• d6la3a_ first appeared in SCOPe 2.07