Lineage for d1nskn_ (1nsk N:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603860Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)
  8. 603868Domain d1nskn_: 1nsk N: [39086]

Details for d1nskn_

PDB Entry: 1nsk (more details), 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2

SCOP Domain Sequences for d1nskn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nskn_ d.58.6.1 (N:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens)}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

SCOP Domain Coordinates for d1nskn_:

Click to download the PDB-style file with coordinates for d1nskn_.
(The format of our PDB-style files is described here.)

Timeline for d1nskn_: