Lineage for d1nskr_ (1nsk R:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504418Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 504419Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 504420Protein Nucleoside diphosphate kinases [54921] (9 species)
  7. 504487Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)
  8. 504497Domain d1nskr_: 1nsk R: [39082]

Details for d1nskr_

PDB Entry: 1nsk (more details), 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2

SCOP Domain Sequences for d1nskr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nskr_ d.58.6.1 (R:) Nucleoside diphosphate kinases {Human (Homo sapiens)}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

SCOP Domain Coordinates for d1nskr_:

Click to download the PDB-style file with coordinates for d1nskr_.
(The format of our PDB-style files is described here.)

Timeline for d1nskr_: