Lineage for d1nuef_ (1nue F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724190Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)
  8. 724196Domain d1nuef_: 1nue F: [39081]
    complexed with gdp, mg

Details for d1nuef_

PDB Entry: 1nue (more details), 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1nuef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuef_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOP Domain Coordinates for d1nuef_:

Click to download the PDB-style file with coordinates for d1nuef_.
(The format of our PDB-style files is described here.)

Timeline for d1nuef_: