SCOP 1.71: Domain d1nuef_: 1nue F:

Lineage for d1nuef_ (1nue F:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)

8. Domain d1nuef_: 1nue F: [39081]
   complexed with gdp, mg

Details for d1nuef_

PDB Entry: 1nue, 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution

SCOP Domain Sequences for d1nuef_:

Sequence; same for both SEQRES and ATOM records:

>d1nuef_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens)}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

Timeline for d1nuef_:

• d1nuef_ first appeared (with stable ids) in SCOP 1.55
  
• d1nuef_ appears in SCOP 1.69
  
• d1nuef_ appears in SCOP 1.73
  
• d1nuef_ appears in the current release, SCOPe 2.08